PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof020287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HSF
Protein Properties Length: 115aa    MW: 12675.1 Da    PI: 4.7784
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-124509PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind69.66.6e-2246102258
                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHH CS
  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLn 58 
                   Fl+k+++++ed++++ ++sws+ gnsfvv+d++ fa+ +Lp+ Fkh+nf+SFvRQL 
     Sof020287  46 FLTKTFDLVEDPATDAVVSWSRAGNSFVVWDPHVFADAMLPRLFKHNNFSSFVRQLT 102
                   9******************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.0E-2439102IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004159.5E-1842111IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.25E-2044102IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.9E-1946102IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.1E-124669IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.1E-128496IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.1E-1297109IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MDPSVAPGIV KEELLEQHQP MQDGVGGGGA APRPMEGLHE VGPPPFLTKT FDLVEDPATD  60
AVVSWSRAGN SFVVWDPHVF ADAMLPRLFK HNNFSSFVRQ LTPIYMEQHT GWSTX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B8e-18251021685Heat shock factor protein 1
5d5v_B8e-18251021685Heat shock factor protein 1
5d5v_D8e-18251021685Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467215.15e-64hypothetical protein SORBIDRAFT_01g021490
SwissprotQ338B01e-53HFA2C_ORYSJ; Heat stress transcription factor A-2c
TrEMBLA0A096PWV54e-64A0A096PWV5_MAIZE; Uncharacterized protein
TrEMBLC5X1F46e-64C5X1F4_SORBI; Putative uncharacterized protein Sb01g021490
STRINGSb01g021490.12e-63(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.11e-35heat shock transcription factor A6B